General description
Forkhead box O1/forkhead in rhabdomyosarcoma (FOXO1, FKH1, FKHR, FOXO1A), a forkhead transcription factor, is a preadipocye and myogenic differentiation factor and embryonic stem cell (ESC) maintenance factor that regulates gluconeogenesis and glycogenolysis by insulin signaling.
Rabbit polyclonal anti-FOXO1 antibody reacts with bovine, pig, canine, human, mouse, rat, zebrafish, and chicken Forkhead box O1/forkhead in rhabdomyosarcoma transcription factors.
Immunogen
Synthetic peptide directed towards the C terminal region of human FOXO1
Application
Rabbit Anti-FOXO1 (AB2) antibody can be used for western blot applications at 1μg/ml.
Rabbit polyclonal anti-FOXO1 antibody is used to tag Forkhead box O1/forkhead in rhabdomyosarcoma for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Forkhead box O1/forkhead in rhabdomyosarcoma in cell differentiation, ESC maintenance and processes such as gluconeogenesis and glycogenolysis.
Biochem/physiol Actions
This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Sequence
Synthetic peptide located within the following region: HPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32107-100UL