Immunogen
Synthetic peptide directed towards the N terminal region of human FUCA1
Application
Anti-FUCA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Biochem/physiol Actions
FUCA1 gene encodes a lysosomal enzyme, α-L-fucosidase mapped on to chromosome 1 at position 1p34.1-1p36. α-L-fucosidase plays a crucial role in hydrolyzing the fucose-containing glycoproteins and glycolipids. Presence of α-L-fucosidase in preoperative serum serves as a prognostic indicator for hepatocellular carcinoma. Mutation in FUCA1 gene leads to fucosidosis, an autosomal recessive lysosomal storage disease.
Sequence
Synthetic peptide located within the following region: PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51172330
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV54293-100UL
