General description

This gene encodes the catalytic subunit of glucose-6-phosphatase (G6Pase). G6Pase is located in the endoplasmic reticulum (ER) and catalyzes the hydrolysis of glucose-6-phosphate to glucose and phosphate in the last step of the gluconeogenic and glycogenolytic pathways. Mutations in this gene result in autosomal recessive severe congenital neutropenia. Multiple transcript variants have been found for this gene, only one of which is expected to express a protein.

Immunogen

Synthetic peptide directed towards the N-terminal region of Human G6PC3

Sequence

Synthetic peptide located within the following region: ESGYYSQAPAQVHQFPSSCETGPGSPSGHCMITGAALWPIMTALSSQVAT

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.