General description
GA-binding protein (GABP) is a member of Ets family of transcription factors that functions as a heterodimer. The α subunit binds to DNA while the β subunit enables transactivation of the target genes.
Immunogen
Synthetic peptide directed towards the C terminal region of human GABPA
Application
Anti-GABPA antibody produced in rabbit is suitable for western blotting at a concentration of 0.5-1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions
GABPA subunit has a distinct role cell cycle progression, embryogenesis and synaptic function at neuromuscular junctions. It is reported to regulate the cell migration and cytoskeletal changes in breast epithelial cells.
Sequence
Synthetic peptide located within the following region: KWGQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV100832-100UL
