General description
GABA-A is a receptor for the major inhibitory neurotransmitter in mammalian brain, gamma-aminobutyric acid (GABA). Gamma-Aminobutyric acid (GABA) A receptor, α-2 (GABRA2) is one of sixteen subunits of GABA-A receptors currenly identified. Variants in GABRA2 have been cautiously associated with alcoholism.
Rabbit polyclonal anti-GABRA2 antibody reacts with canine, bovine, human, mouse, and rat Gamma-Aminobutyric acid (GABA) A receptor, α-2 subunits.
Immunogen
Synthetic peptide directed towards the middle region of human GABRA2
Application
Rabbit polyclonal anti-GABRA2 antibody is used to tag Gamma-Aminobutyric acid (GABA) A receptor, α-2 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Gamma-Aminobutyric acid (GABA) A receptor, α-2 in alcohol dependency/alcoholism. Anti-GABRA2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Sequence
Synthetic peptide located within the following region: PMDAHSCPLKFGSYAYTTSEVTYIWTYNASDSVQVAPDGSRLNQYDLLGQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51141589
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV13026-100UL
