General description
GABRE is a ligand-gated ion-channel that codes for the ε subunit of γ-aminobutyric acid (GABA) A receptor. Rabbit anti-GABRE antibody reacts with mouse, human, and rat GABRE.
Immunogen
Synthetic peptide directed towards the middle region of human GABRE
Application
Rabbit Anti-GABRE antibody is suitable for western blot applications at a concentration of 2.0 μg/ml.
Biochem/physiol Actions
GABRE belongs to the ligand-gated ionic channel (TC 1.A.9) family. It encodes the gamma-aminobutyric acid (GABA) A receptor which is a multisubunit chloride channel that mediates the fastest inhibitory synaptic transmission in the central nervous system. This gene encodes an epsilon subunit. It is mapped to chromosome Xq28 in a cluster comprised of genes encoding alpha 3, beta 4 and theta subunits of the same receptor. Alternatively spliced transcript variants encoding different isoforms have been identified.
Sequence
Synthetic peptide located within the following region: KNSWKLFQFDFTGVSNKTEIITTPVGDFMVMTIFFNVSRRFGYVAFQNYV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51143706
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV35342-100UL
