ANTI-GATA3

General description

GATA3 facilitates the expression of Th2 gene in CD4⁺ T cells. Studies in mice have reported that GATA3 disruptions can induce defects in nervous system and fetal liver hematopoiesis.
Rabbit Anti-GATA3 antibody recognizes chicken, bovine, canine, pig, human, mouse, and rat GATA3.

Rabbit polyclonal anti-GATA3 antibody reacts with chicken, bovine, canine, pig, human, mouse, and rat GATA binding protein 3 transcription factors.

Trans-acting T-cell-specific transcription factor GATA binding protein 3 (GATA3) is a tissue specific transcription factor involved in endothelial cell biology and the regulation of T-cell development. GATA3 plays a role in the development, survival, and function of innate lymphoid cell (ILC) subpopulations. GATA3 differentially regulates T(h)1/T(h)2 differentiation. It promotes the secretion of factors such as IL-4, IL-5 and IL-13 from Th2 cells.

Immunogen

Synthetic peptide directed towards the C terminal region of human GATA3

Application

Rabbit Anti-GATA3 antibody can be used for western blot (0.2-2.0μg/ml) and IHC (4-8μg/ml) applications.

Rabbit polyclonal anti-GATA3 antibody is used to tag GATA binding protein 3 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of GATA binding protein 3 in endothelial and T-cell biology and differentiation.

Biochem/physiol Actions

Trans-acting T-cell specific transcription factor GATA-3 is a member of GATA family of transcription factors that regulates development of multiple tissues. It is an important transcription factor in regulating human Th2 cell differentiation in vivo.

Sequence

Synthetic peptide located within the following region: RNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.