Immunogen
Synthetic peptide directed towards the C terminal region of mouse GATA5
Biochem/physiol Actions
GATA5 is induced at an early stage of endothelial-endocardial differentiation prior to expression of such early endocardial markers as Tie2 and ErbB3. It is required for differentiation of cardiogenic precursors into endothelial endocardial cells.
Sequence
Synthetic peptide located within the following region: SPTLLNSESSATTLKAESSLASPVCAGPTITSQASSPADESLASSHLEFK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV36860-100UL