Immunogen

Synthetic peptide directed towards the middle region of human GBP4

Biochem/physiol Actions

GBP4 belongs to the GBP family. It binds GTP, GDP and GMP. Hydrolyzes GTP very efficiently; GDP rather than GMP is the major reaction product. GBP4 plays a role in erythroid differentiation.

Sequence

Synthetic peptide located within the following region: NAVTALAQLENPAAVQRAADHYSQQMAQQLRLPTDTLQELLDVHAACERE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.