General description
GCNT4 codes for glucosaminyl (N-acetyl) transferase 4, core 2, which is involved in the processing of O-glycans. GCNT4 can facilitate O-linked glycosylation of proteins.
Rabbit Anti-GCNT4 antibody recognizes chicken, canine, and human GCNT4.
Immunogen
Synthetic peptide directed towards the C terminal region of human GCNT4
Application
Rabbit Anti-GCNT4 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
GCNT4 is a glycosyltransferase that mediates core 2 O-glycan branching, an important step in mucin-type biosynthesis. It does not have core 4 O-glycan or I-branching enzyme activity.
Sequence
Synthetic peptide located within the following region: SKDTYSPDEHFWATLIRVPGIPGEISRSAQDVSDLQSKTRLVKWNYYEGF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47278-100UL
