Immunogen

Synthetic peptide directed towards the N terminal region of human GLE1

Application

Anti-GLE1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

Biochem/physiol Actions

GLE1 is required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. It may be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC). Mutations in GLE1 result in a fetal motoneuron disease.

Sequence

Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.