ANTI-GNMT (C15-1744-163)

Immunogen

The immunogen for anti-GNMT antibody: synthetic peptide derected towards the N terminal of human GNMT

Biochem/physiol Actions

Gnmt catalyzes the methylation of glycine by using S-adenosylmethionine (AdoMet) to form N-methylglycine (sarcosine) with the concomitant production of S-adenosylhomocysteine (AdoHcy). It plays a possible crucial role in the regulation of tissue concentration of AdoMet and of metabolism of methionine.

Sequence

Synthetic peptide located within the following region: GVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCHRV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.