Immunogen
Synthetic peptide directed towards the N terminal region of human GRIK4
Application
Anti-GRIK4 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
GRIK4 or glutamate receptor 4 receptor subunit modulates the synaptic transmission and cellular excitability in the brain. Mutations in GRIK4 gene have been associated with major psychiatric disorders such as schizophrenia and bipolar disorder.
Sequence
Synthetic peptide located within the following region: RAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPAS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV13040-100UL