Immunogen
Synthetic peptide directed towards the C terminal region of human GSN
Application
Anti-GSN antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
GSN gene encodes a 93,000-dalton actin-modulating protein localized in the cytoplasm of cells. It plays a pivotal role in regulating actin filament length as well as prevents monomer exchange by blocking or capping the "plus" ends of actin monomers and filaments. Defects in GSN gene leads to familial amyloidosis Finnish type (FAF).
Sequence
Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV54299-100UL