Immunogen
Synthetic peptide directed towards the N terminal region of human GSTZ1
Application
Anti-GSTZ1 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
Glutathione S-transferase zeta 1 (GSTZ1) belongs to glutathione S-transferase (GSTs) super-family involved in detoxification of carcinogens and drugs by conjugation with glutathione. GSTZ1 is also involved in the metabolism of phenylalanine and tyrosine. Defects in GSTZ1 gene result in metabolic disorders such as phenylketonuria, alkaptonuria and tyrosinaemia.
Sequence
Synthetic peptide located within the following region: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352202
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV49036-100UL