General description
GTF2H3 belongs to the TFB4 family of transcription factors and forms a part of the TFIIH complex. GTF2H3 regulates nucleotide excision repair and RNA polymerase II-mediated transcription.
Rabbit Anti-GTF2H3 antibody recognizes bovine, human, mouse, and rat GTF2H3.
Immunogen
Synthetic peptide directed towards the N terminal region of human GTF2H3
Application
Rabbit Anti-GTF2H3 antibody can be used for western blot (2μg/ml) and immunohistochemistry (4-8μg/ml) assays.
Biochem/physiol Actions
GTranscription Factor Antibodies2H3 interacts with HIV-1 Tat as a component of the HIV-1 transcription pre-initiation complex, but is released from the elongation complex which includes P-TEFb. It synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter.
Sequence
Synthetic peptide located within the following region: VIASHIQESRFLYPGKNGRLGDFFGDPGNPPEFNPSGSKDGKYELLTSAN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV31438-100UL