General description
β-Glucuronidase (GUSB), a lysosomal enzyme, catalyzes the breakdown of complex carbohydrates by hydrolyzing β-D-glucuronic acid residues from the non-reducing end of mucopolysaccharides. GUSB is a stably expressed gene product that may be used to normalize the expression of other genes in processes such as mesenchymal stem cell differentiation.
Specificity
Anti-GUSB polyclonal antibody reacts with canine, bovine, zebrafish, chicken, human, mouse, rat, and pig β-glucuronidase proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human GUSB
Application
Anti-GUSB polyclonal antibody is used to tag β-glucuronidase protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe detect the presence of β-glucuronidase as a gene expression normalization reference protein.
Biochem/physiol Actions
GUSB plays an important role in the degradation of dermatan and keratan sulfates.
Sequence
Synthetic peptide located within the following region: VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44234-100UL