General description
H3F3A is a H3 histone protein that has been implicated in pediatric astrocytoma and glioblastoma. Rabbit Anti-H3F3A antibody binds to human H3F3A.
Immunogen
Synthetic peptide directed towards the N terminal region of human HIST3H3
Application
Rabbit Anti-H3F3A antibody can be used for western blot (1μg/ml) assays.
Sequence
Synthetic peptide located within the following region: MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV01011-100UL