General description
Anti-Heme Oxygenase-1 (1-30), rabbit polyclonal, recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2. It is validated for use in Western blotting and immunoprecipitation.
Protein A purified rabbit polyclonal antibody. Recognizes the ~32 kDa HO-1 protein.
Recognizes the ~32 kDa HO-1 protein. Does not cross-react with HO-2.
Immunogen
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Application
Immunoblotting (1:1000, chemiluminescence)
Immunoprecipitation (1:100)
Warning
Toxicity: Standard Handling (A)
Physical form
In PBS, 50% glycerol, pH 7.2.
Reconstitution
Following initial thaw, aliquot and freeze (-20°C).
Other Notes
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Maines, M.D. 1988 FASEB J.2, 2557.
Kutty, R.K., et al. 1994. J. Cell Physiol.159, 371.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Legal Information
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
biological source: rabbit. Quality Level: 100. antibody form: purified antibody. antibody product type: primary antibodies. clone: polyclonal. form: liquid. contains: ≤. 0.1% sodium azide as preservative. species reactivity: human, hamster, monkey, mouse, rat, canine. manufacturer/tradename: Calbiochem®. . storage condition: OK to freeze, avoid repeated freeze/thaw cycles. isotype: IgG. shipped in: ambient. storage temp.: −. 20°C. target post-translational modification: unmodified. Gene Information: human ... HMOX1(3162). Storage Class Code: 10 - Combustible liquids. WGK: WGK 1.- UPC:
- 51131802
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- 374090-100UL