General description

HEMGN regulates the proliferation and differentiation of hematopoietic cells. Overexpression of HEMGN block the TPA-induced megakaryocytic differentiation in the K562 cell model. HEMGN may also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).

Immunogen

Synthetic peptide directed towards the N terminal region of human HEMGN

Sequence

Synthetic peptide located within the following region: MDLGKDQSHLKHHQTPDPHQEENHSPEVIGTWSLRNRELLRKRKAEVHEK

Physical form

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.