General description
Hypermethylated in cancer 2 (HIC2 or HRG22) is a transcriptional repressor that can self-associate and also interact with HIC1.
Rabbit Anti-HIC2 antibody recognizes human, mouse, rat, bovine, and canine HIC2.
Immunogen
Synthetic peptide directed towards the N terminal region of human HIC2
Application
Rabbit Anti-HIC2 antibody is suitable for western blot applications at a concentration of 2.0 μg/ml.
Biochem/physiol Actions
HIon Channel2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor.
Sequence
Synthetic peptide located within the following region: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVII
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51312407
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV39170-100UL