Immunogen
Synthetic peptide directed towards the C terminal region of human HMGB3
Biochem/physiol Actions
HMGB3 belongs to high mobility group of proteins and contains HMG box domain that binds DNA. It plays a critical role in DNA replication, nucleosome assembly and transcription. HMGB3 reportedly regulates cell proliferation, migration and invasion of B cells and gastric cancer cells.
Sequence
Synthetic peptide located within the following region: NLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKVEE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51282115
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV35766-100UL