General description
HNF4G is a nuclear receptor that regulates hyaluronan synthase 2 (HAS2) and facilitates the metastasis of bladder cancer.
Rabbit Anti-HNF4G recognizes chicken, mouse, canine, bovine, human, and rat HNF4G.
The previously assigned protein identifier Q7Z2V9 has been merged into Q14541. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the C terminal region of human HNF4G
Application
Rabbit Anti-HNF4G (AB1) antibody can be used for western blot applications at concentration of 1.0μg/ml.
Biochem/physiol Actions
HNF4 was first identified as a DNA binding activity in rat liver nuclear extracts and then was found to be an orphan member of the nuclear receptor superfamily. Binding sites for this factor were identified in many tissue-specifically expressed genes, and the protein was found to be essential for early embryonic development in the mouse
Sequence
Synthetic peptide located within the following region: MSTLVHADQISTPETPLPSPPQGSGQEQYKIAANQASVISHQHLSKQKQL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41105328
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31947-100UL
