General description
HOXA1 is a homeobox transcription factor that may regulate differentiation and morphogenesis in cells. Mutations in HOXA1 have been linked to the risk of autism spectrum disorders and defects in the central nervous system.
Rabbit HOXA1 antibody recognizes human, mouse, rat, rabbit, bovine, and canine HOXA1.
Immunogen
Synthetic peptide directed towards the middle region of human HOXA1
Application
Rabbit HOXA1 antibody is suitable for western blot (2.5 μg/ml) and IHC (4-8 μg/ml) applications.
Biochem/physiol Actions
In vertebrates, the genes encoding the class of transcription factors called homeobox genes are found in clusters named A, B, C, and D on four separate chromosomes. Expression of these proteins is spatially and temporally regulated during embryonic development. HOXA1 is part of the A cluster on chromosome 7 and encodes a DNA-binding transcription factor which may regulate gene expression, morphogenesis, and differentiation. The encoded protein may be involved in the placement of hindbrain segments in the proper location along the anterior-posterior axis during development.
Sequence
Synthetic peptide located within the following region: NLGVSYSHSSCGPSYGSQNFSAPYSPYALNQEADPPRSLSLPRIGDIFSS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41106508
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV34773-100UL