Immunogen

Synthetic peptide directed towards the N terminal region of human HSP90AB1

Biochem/physiol Actions

HSP90AB1 (heat shock protein 90kDa α (cytosolic), class B member 1) is a molecular chaperone that mediates protein folding and intracellular trafficking. It interacts with important oncoproteins such as MET, Akt, p53 and Raf-1 kinase and modulates the signaling pathway that results in cell proliferation and survival.

Sequence

Synthetic peptide located within the following region: MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.