General description
HSPB6 (Hsp20) encodes a heat shock protein that may be involved in the relaxation of smooth muscles. It is known to interact with Bag3. HSPB6 has also been implicated in platelet aggregation, atherosclerosis, myocardial infarction, insulin resistance and Alzheimer′s disease.
Rabbit Anti-HSPB6 antibody recognizes canine, bovine, human, mouse, rat, chicken, and pig HSPB6.
Immunogen
Synthetic peptide directed towards the middle region of human HSPB6
Application
Rabbit Anti-HSPB6 antibody is suitable for western blot applications at a concentration of 1.25μg/ml.
Biochem/physiol Actions
HSPB6 is associated with actin and modulates smooth muscle relaxation.HSPB6 is associated with actin (see MIM 102540) and modulates smooth muscle relaxation (Tessier et al., 2003 [PubMed 12842460]).[supplied by OMIM].
Sequence
Synthetic peptide located within the following region: ARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPAS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51131907
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV48436-100UL