Immunogen

Synthetic peptide directed towards the N terminal region of human HTR1F

Application

Anti-HTR1F antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.

Biochem/physiol Actions

HTR1F is a post-synaptic 5-hydroxytryptamine (5-HT) receptor important in serotonergic functions. It negatively regulates 5-HT neuronal activity and has been implicated in mood regulation and responses to stress and emotions.

Sequence

Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.