General description
Insulin-like growth factor binding protein 7 (IGFBP7) is a protein that strongly binds to IGF-I and with low affinity to IGF-II. It is known to mediate cell adhesion and the production of prostacyclin. Loss of IGFBP7 expression has been associated with tumorigenesis.
Rabbit Anti-IGFBP7 antibody recognizes human, canine, bovine, pig, mouse, and rat IGFBP7.
Immunogen
Synthetic peptide directed towards the C terminal region of human IGFBP7
Application
Rabbit Anti-IGFBP7 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.
Sequence
Synthetic peptide located within the following region: RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48174-100UL