General description
INSM1 is a zinc finger protein that regulates neuroendocrine differentiation. This protein is also known to repress the transcription of neuroD/b2 gene.
Rabbit Anti-INSM1 antibody recognizes human INSM1.
Immunogen
Synthetic peptide directed towards the C terminal region of human INSM1
Application
Rabbit Anti-INSM1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Biochem/physiol Actions
The insulinoma-associated 1 (INSM1) gene is intronless and encodes a protein containing both a zinc finger DNA-binding domain and a putative prohormone domain. This gene is a sensitive marker for neuroendocrine differentiation of human lung tumors.
Sequence
Synthetic peptide located within the following region: LQAKGAPLAPPAEDLLALYPGPDEKAPQEAAGDGEGAGVLGLSASAECHL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51142035
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV32667-100UL
