ANTI-IRF1 (C15-1341-079)

General description

Interferon regulatory factor 1 (IRF1) is a transcription factor and gene trans-activator that activates interferon-β and various other target gene expression to help regulate cell processes such as the immune response, apoptosis, and tumor suppression.

Specificity

Anti-IRF1 (AB2) polyclonal antibody reacts with chicken, pig, canine, bovine, human, mouse, and rat interferon regulatory factor 1 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human IRF1

Application

Anti-IRF1 (AB2) polyclonal antibody is used to tag interferon regulatory factor 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of interferon regulatory factor 1 in gene expression of proteins involve in the immune response, apoptosis, and tumor suppression.

Biochem/physiol Actions

IRF1 is interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppression.

Sequence

Synthetic peptide located within the following region: MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.