General description
The gene Junctional adhesion molecule 3 (JAM3; JAM-C) is mapped to human chromosme 11q25. JAM3 is a type I transmembrane glycoprotein and contains Ig-like domains. It belongs to Ig-superfamily called as JAMs. JAM3 is widely expressed with predominant expression in placenta, brain and kidney. It is also expressed in platelets but not in other blood cells.
Immunogen
Synthetic peptide directed towards the N terminal region of human JAM3
Application
Anti-JAM3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Junctional adhesion molecule 3 (JAM3; JAM-C) is a protein localized at the tight junctions of endothelial cells and acts as a receptor for another JAM molecule. JAM3 is involved in the regulation of vascular permeability, angiogenesis and nerve function. Deficient expression of JAM3 results in severe hydrocephalus and development of tumors in murine models. JAM3 is involved in lymphangiogenesis and nodal metastasis in non-small cell lung cancer. It is also associated with melanoma cell metastasis.
Sequence
Synthetic peptide located within the following region: SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51173210
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50121-100UL