ANTI-KDM6A (C15-1445-529)

General description

Lysine-specific demethylase 6A (KDM6A) is a tumor suppressor gene mapped to human chromosome Xp11.3. The gene codes for histone H3 lysine 27 (H3K27) demethylase, which is a member of the switch/sucrose non-fermentable (SWI/SNF) family.

Immunogen

Ubiquitously transcribed X chromosome tetratricopeptide repeat protein (Ubiquitously transcribed TPR protein on the X chromosome)

Sequence
IGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHT

Application

ANTI-KDM6A antibody produced in rabbit has been used in western blotting and immunoprecipitation.

Biochem/physiol Actions

Lysine-specific demethylase 6A (KDM6A) counteracts zeste homolog 2 (EZH2) function and induces tumor suppression by stimulating gene transcription of E-cadherin, cell cycle regulators and tumor-suppressing subchromosomal transferable fragments. It also eliminates trimethylation marks from histone 3 lysine 27 (H3K27) and supports histone demethylase activity through its catalytic JmjC domain. Mutation in the gene leads to the development of a rare congenital anomaly syndrome, Kabuki syndrome (KS).

Features and Benefits

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST85171.

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Sigma-Aldrich Co. LLC

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.