General description
KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), is a proliferating cell nuclear antigen-associated factor. It is a 15kDa protein. It is highly expressed in thymus and colon. KIAA0101 gene is located on the human chromosome 15q22.31.
Immunogen
KIAA0101 (NP_055551.1, 1 a.a. ~ 111 a.a) full-length human protein.
Sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNSTSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFRLSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDHTNDEKE
Biochem/physiol Actions
KIAA0101, also known as, proliferating cell nuclear antigen (PCNA) clamp associated factor (PCLAF), helps in regulating DNA repair, cell cycle progression and cell proliferation. Overexpression of KIAA0101 inhibits UV-induced cell death. It is also used as a prognostic marker for hepatocellular carcinoma(HCC). Overexpression of KIAA0101 acts as a marker for adrenocortical carcinoma (ACC) and human gastric cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51172318
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1406878-50UG
- Temperature Control Device:
- Yes
