Immunogen
Synthetic peptide directed towards the C terminal region of human KIFC3
Biochem/physiol Actions
KIFC3 belongs to the kinesin-like protein family. It contains 1 kinesin-motor domain. KIFC3 is the minus-end microtubule-dependent motor protein. It is involved in apically targeted transport.
Sequence
Synthetic peptide located within the following region: EHLEWEPACQTPQPSARAHSAPSSGTSSRPGSIRRKLQPSGKSRPLPV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV33911-100UL