General description
Kruppel-like factor 1 (erythroid) is a transcription factor required for the proper differentiation of erythroid (red blood) cells from bipotent progenitor cells. Kruppel-like factor 1 regulates erythroid cell differenation and maturation via the processes of transcriptional activation, gamma to β globin switching and chromatin remodeling.
Rabbit polyclonal anti-KLF1 antibody reacts with pig, human, and bovine Kruppel-like factor 1 (erythroid) transcription factors.
Immunogen
Synthetic peptide directed towards the middle region of human KLF1
Application
Rabbit Anti-KLF1 antibody can be used for western blot applications at a concentration of 2.5μg/ml.
Rabbit polyclonal anti-KLF1 antibody is used to tag Kruppel-like factor 1 (erythroid) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Kruppel-like factor 1 (erythroid) in erythroid cell differentiation and maturation.
Biochem/physiol Actions
KLF1 is a transcription factor, originally identified in this laboratory, which plays a crucial role as a transcriptional activator at the adult beta-globin locus.
Sequence
Synthetic peptide located within the following region: SVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV32810-100UL