ANTI-KLF2 (C15-1743-754)

Sigma Aldrich

Catalog No.: C15-1743-754
Manufacturer No.: SAB2108355-100UL
Manufacturer Name: Sigma-Aldrich
Quantity: 1
Unit of Measure: EA

Price: $980.46

List Price: $1,089.40

Immunogen Synthetic peptide directed towards the N terminal of human Klf2 Biochem/physiol Actions Klf2 binds to the CACCC box in the beta-globin gene promoter and activates transcription. Sequence Synthetic peptide located within the following

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account. Contact Us

Current Stock:

Quantity:

Adding to cart… The item has been added

Description
Specifications

Immunogen

Synthetic peptide directed towards the N terminal of human Klf2

Biochem/physiol Actions

Klf2 binds to the CACCC box in the beta-globin gene promoter and activates transcription.

Sequence

Synthetic peptide located within the following region: MALSEPILPSFATFASPCERGLQERWPRNEPEAGGTDEDLNNVLDFILSM

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

UPC:: 12352203
Condition:: New
Availability:: 3-5 Days
Weight:: 1.00 Ounces
HazmatClass:: No
WeightUOM:: LB
MPN:: SAB2108355-100UL
Product Size:: 100/µL

Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.

"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."