Immunogen
Synthetic peptide directed towards the C terminal region of human KRT14
Application
Anti-KRT14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
Keratins are abundantly present structural proteins in epithelial cells. Keratins 5 and 14 are primary structural proteins of stratifying epithelia. Mutations in K14 gene or defects in K5-K14 network results in Epidermolysis bullosa simplex, a condition characterized by superficial bullous lesions on skin epithelia.
Sequence
Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV15002-100UL