General description
Keratin 15 (KRT15) is an intermediate filament protein that regulates the structure of epithelial cells. Rabbit Anti-KRT15 antibody binds to bovine, human, mouse, and rat KRT15.
Immunogen
Synthetic peptide directed towards the C terminal region of human KRT15
Application
Rabbit Anti-KRT15 antibody can be used for western blot (1μg/ml) and immunohistochemistry (4-8μg/ml, using paraffin embedded tissues) applications.
Sequence
Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV00005-100UL