ANTI-LHX3

General description

LHX3 is a LIM homeodomain protein that functions as a transcription factor and is required for the development of pituitary gland. It also determines the cell types that secrete anterior pituitary hormones. Mutations in LHX3 have been linked to combined pituitary hormone deficiency in humans.
Rabbit Anti-LHX3 (AB1) antibody recognizes canine, human, zebrafish, bovine, chicken, pig, and mouse LHX3.

Immunogen

Synthetic peptide directed towards the middle region of human LHX3

Application

Rabbit Anti-LHX3 (AB1) antibody can be used for western blot applications at a concentration of 0.5μg/ml.

Biochem/physiol Actions

LHX3 is a member a large protein family which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor that is required for pituitary development and motor neuron specification. Mutations in this gene have been associated with a syndrome of combined pituitary hormone deficiency and rigid cervical spine. Two transcripts variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: NMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.