Immunogen
Synthetic peptide directed towards the N terminal region of human LIN9
Application
Anti-LIN9 (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Lin-9 homolog (C. elegans) is a tumor suppressor that associates with retinoblastoma 1 protein and inhibits DNA synthesis and regulates cell cycle and cell cycle-dependent gene expression. LIN9 is a subunit of DREAM complex and regulates gene expression and proliferation of embryonic stem cells.
Sequence
Synthetic peptide located within the following region: TRKLTRVEWGKIRRLMGKPRRCSSAFFEEERSALKQKRQKIRLLQQRKVA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352202
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50821-100UL