Immunogen

Synthetic peptide directed towards the middle region of Human LRRC59

Application

Anti-LRRC59 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.

Biochem/physiol Actions

Leucine rich repeat containing 59 (LRRC59) is a ribosome receptor localized to endoplasmic reticulum. It also acts as an intracellular binding partner of Fibroblast growth factor 1 (FGF1) and regulates its nuclear import.

Sequence

Synthetic peptide located within the following region: KEYDALKAAKREQEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.