Immunogen
Synthetic peptide directed towards the N terminal region of human LYZL6
Application
Anti-LYZL6 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
LYZL6 (lysozyme-like 6) gene encodes a 148 amino acid containing secreted protein that belongs to glycosyl hydrolase 22 family and is predominantly expressed in testis and epididymis. It may facilitate the maturation and/or storage of sperm and might play a role in contributing to the innate immunity of the male genital tract. LYZL6 also possesses bacteriolytic activity against Micrococcus lysodeikticus.
Sequence
Synthetic peptide located within the following region: MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201805
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV53746-100UL