General description
Monoamine oxidase B (MAOB) is a flavin monoamine oxidase that catalyzes oxidative deamination of biogenic and xenobiotic amines. MAOB is found in the mitochondrial outer membrane. Dopamine is a major substrate of MAOB making it a target for the potential treatment of Parkinson′s disease and obesity.
Specificity
Anti-MAOB polyclonal antibody reacts with human, mouse, pig, bovine, canine, chicken, and rat monoamine oxidase B proteins.
Immunogen
Synthetic peptide directed towards the C terminal region of human MAOB
Application
Anti-MAOB polyclonal antibody is used to tag monoamine oxidase B for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of monoamine oxidase B in oxidative deamination of important amines such as the neurotransmitter dopamine.
Biochem/physiol Actions
MAOB belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.The protein encoded by this gene belongs to the flavin monoamine oxidase family. It is a enzyme located in the mitochondrial outer membrane. It catalyzes the oxidative deamination of biogenic and xenobiotic amines and plays an important role in the metabolism of neuroactive and vasoactive amines in the central nervous sysytem and peripheral tissues. This protein preferentially degrades benzylamine and phenylethylamine.
Sequence
Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV43557-100UL