ANTI-MATR3 (C15-1341-286)

General description

Matrin 3 (MATR3) is a zinc finger inner nuclear matrix protein with two RNA recognition motifs (RRM). MATR3, which is highly regulated, complexes with and stabilizes specific gene transcripts that are currently being identified. Rev appears to be a MATR3 cofactor.

Specificity

Anti-MATR3 (AB1) polyclonal antibody reacts with chicken, human, mouse, rat, and bovine matrin 3 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human MATR3

Application

Anti-MATR3 (AB1) polyclonal antibody is used to tag matrin 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of matrin 3 as a selective nuclear gene transcript stabilizer.

Biochem/physiol Actions

MATR3 is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network.The protein encoded by this gene is localized in the nuclear matrix. It may play a role in transcription or may interact with other nuclear matrix proteins to form the internal fibrogranular network. Two transcript variants encoding the same protein have been identified for this gene.

Sequence

Synthetic peptide located within the following region: MSKSFQQSSLSRDSQGHGRDLSAAGIGLLAAATQSLSMPASLGRMNQGTA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.