Immunogen

Synthetic peptide directed towards the middle region of human MBNL2

Application

Anti-MBNL2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.

Biochem/physiol Actions

Muscleblind-like splicing regulator 2 (MBNL2) is a C3H-type zinc finger protein that modulates the alternate splicing of pre-mRNA molecules. MBNL2-mediated splicing program is essential in the developing brain. The dysregulation of MBNL2 splicing activity results in myotonic dystrophy.

Sequence

Synthetic peptide located within the following region: ENGRVIACFDSLKGRCSRENCKYLHPPTHLKTQLEINGRNNLIQQKTAAA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.