Immunogen
Synthetic peptide directed towards the middle region of human MCM7
Biochem/physiol Actions
Minichromosome maintenance complex component 7 (MCM7) is one of the mini-chromosome maintenance proteins that are crucial for eukaryotic genome replication. MCM proteins are key components of the pre-replication complex, recruit replication-related proteins and form replication forks. MCM7 interacts with receptor for activated protein kinase C 1 (RACK1) and controls DNA synthesis and the entry of the cells into S phase.
Sequence
Synthetic peptide located within the following region: HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV36652-100UL