General description
The previously assigned protein identifier Q6P8Q3 has been merged into Q60929. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of mouse MEF2A
Biochem/physiol Actions
MEF2a belongs to MEF2 family. Members of MEF2 family of transcription factors bind a conserved A/T-rich sequence in the control regions of numerous muscle-specific genes
Sequence
Synthetic peptide located within the following region: ESRTNSDIVETLRKKGLNGCESPDADDYFEHSPLSEDRFSKLNEDSDFIF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV37186-100UL