General description
Anti-METTL1 antibody codes for methyltransferase like 1 that has an S-adenosylmethionine-binding motif. It is inactivated upon phosphorylation by PKB and RSK. A functional variant in METTL1, along with other genetic variants, has been associated with multiple sclerosis.
Rabbit Anti-METTL1 antibody recognizes bovine, human, mouse, and rat METTL1.
Immunogen
Synthetic peptide directed towards the middle region of human METTL1
Application
Rabbit Anti-METTL1 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
METTL1 contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation.This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
Sequence
Synthetic peptide located within the following region: KGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDV
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48665-100UL
