General description
METTL2B codes for methyltransferase like 2B that is involved in tRNA methylation.
Rabbit Anti-METTL2B antibody recognizes human, mouse, rat, canine, zebrafish, and bovine METTL2B.
Immunogen
Synthetic peptide directed towards the N terminal region of human METTL2B
Application
Rabbit Anti-METTL2B antibody is suitable for western blot applications at a concentration of 1 μg/ml.
Biochem/physiol Actions
METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases.This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
Sequence
Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51113204
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48836-100UL