General description
Methyltransferase like 3 (METTL3 or M6A) codes for a 70 kDa subunit of MT-A. This protein forms a heterodimeric complex with METTL14 and subsequently modulates the methylation of the mammalian nuclear RNA, N6-adenosine.
Rabbit Anti-METTL3 antibody recognizes bovine, canine, human, mouse, rat, and zebrafish METTL3.
Immunogen
Synthetic peptide directed towards the N terminal region of human METTL3
Application
Rabbit Anti-METTL3 antibody is suitable for use in western blot (5 μg/ml) and IHC (4-8 μg/ml) applications.
Biochem/physiol Actions
METTL3 is the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.This gene encodes the 70 kDa subunit of MT-A which is part of N6-adenosine-methyltransferase. This enzyme is involved in the posttranscriptional methylation of internal adenosine residues in eukaryotic mRNAs, forming N6-methyladenosine.
Sequence
Synthetic peptide located within the following region: MSDTWSSIQAHKKQLDSLRERLQRRRKQDSGHLDLRNPEAALSPTFRSDS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV39390-100UL